OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NDUF3 (NDUFAF3) (NM_199074) Human Mass Spec Standard

Be the first to review this product
SKU
PH302480
NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951056)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA359897 NDUFAF3 Antibody - N-terminal
100 ul
$585.00
LY404729 Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "NDUF3 or NM_199074"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202480
Predicted MW 20.4 kDa
Protein Sequence
Protein Sequence
>RC202480 protein sequence
Red=Cloning site Green=Tags(s)

MATALALRSLYRARPSLRCPPVELPWAPRRGHRLSPADDELYQRTRISLLQREAAQAMYIDSYNSRGFMI
NGNRVLGPCALLPHSVVQWNVGSHQDITEDSFSLFWLLEPRIEIVVVGTGDRTERLQSQVLQAMRQRGIA
VEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_951056
RefSeq Size 902
RefSeq ORF 552
Synonyms 2P1; C3orf60; E3-3; MC1DN18
Locus ID 25915
UniProt ID A4FU71
Cytogenetics 3p21.31
Summary This gene encodes a mitochondrial complex I assembly protein that interacts with complex I subunits. Mutations in this gene cause mitochondrial complex I deficiency, a fatal neonatal disorder of the oxidative phosphorylation system. Alternatively spliced transcript variants encoding different isoforms have been identified. provided by RefSeq, Jul 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NDUF3" proteins (16)
SKU Description Size Price
PH310699 NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951032) 10 ug
$3,360.00
PH317632 NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951033) 10 ug
$3,360.00
PH317754 NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951047) 10 ug
$3,360.00
LC404729 Lyophilized NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404730 Lyophilized NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404732 Lyophilized NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404733 Lyophilized NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404729 Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 1 (as WB positive control) 100 ug
$436.00
LY404730 Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 2 (as WB positive control) 100 ug
$436.00
LY404732 Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 3 (as WB positive control) 100 ug
$436.00
LY404733 Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 4 (as WB positive control) 100 ug
$436.00
TP302480 Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 4, 20 µg 20 ug
$867.00
TP310699 Recombinant protein of human chromosome 3 open reading frame 60 (C3orf60), transcript variant 1, 20 µg 20 ug
$867.00
TP317632 Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 2, 20 µg 20 ug
$867.00
TP317754 Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 3, 20 µg 20 ug
$867.00
TP318529 Recombinant protein of human chromosome 3 open reading frame 60 (C3orf60), transcript variant 5, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products