NDUF3 (NDUFAF3) (NM_199069) Human Recombinant Protein
SKU
TP310699
Recombinant protein of human chromosome 3 open reading frame 60 (C3orf60), transcript variant 1, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC210699 protein sequence
Red=Cloning site Green=Tags(s) MYIDSYNSRGFMINGNRVLGPCALLPHSVVQWNVGSHQDITEDSFSLFWLLEPRIEIVVVGTGDRTERLQ SQVLQAMRQRGIAVEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_951032 |
Locus ID | 25915 |
UniProt ID | Q9BU61 |
Cytogenetics | 3p21.31 |
RefSeq Size | 1387 |
RefSeq ORF | 381 |
Synonyms | 2P1; C3orf60; E3-3; MC1DN18 |
Summary | This gene encodes a mitochondrial complex I assembly protein that interacts with complex I subunits. Mutations in this gene cause mitochondrial complex I deficiency, a fatal neonatal disorder of the oxidative phosphorylation system. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2009] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH302480 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951056) | 10 ug |
$3,255.00
|
|
PH310699 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951032) | 10 ug |
$3,255.00
|
|
PH317632 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951033) | 10 ug |
$3,255.00
|
|
PH317754 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951047) | 10 ug |
$3,255.00
|
|
LC404729 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC404730 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC404732 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC404733 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY404729 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 1 | 100 ug |
$436.00
|
|
LY404730 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 2 | 100 ug |
$436.00
|
|
LY404732 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 3 | 100 ug |
$436.00
|
|
LY404733 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 4 | 100 ug |
$436.00
|
|
TP302480 | Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 4, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP317632 | Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP317754 | Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP318529 | Recombinant protein of human chromosome 3 open reading frame 60 (C3orf60), transcript variant 5, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.