NDUF3 (NDUFAF3) (NM_199074) Human Mass Spec Standard

SKU
PH302480
NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951056)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202480]
Predicted MW 20.4 kDa
Protein Sequence
Protein Sequence
>RC202480 protein sequence
Red=Cloning site Green=Tags(s)

MATALALRSLYRARPSLRCPPVELPWAPRRGHRLSPADDELYQRTRISLLQREAAQAMYIDSYNSRGFMI
NGNRVLGPCALLPHSVVQWNVGSHQDITEDSFSLFWLLEPRIEIVVVGTGDRTERLQSQVLQAMRQRGIA
VEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_951056
RefSeq Size 902
RefSeq ORF 552
Synonyms 2P1; C3orf60; E3-3; MC1DN18
Locus ID 25915
UniProt ID A4FU71
Cytogenetics 3p21.31
Summary This gene encodes a mitochondrial complex I assembly protein that interacts with complex I subunits. Mutations in this gene cause mitochondrial complex I deficiency, a fatal neonatal disorder of the oxidative phosphorylation system. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2009]
Write Your Own Review
You're reviewing:NDUF3 (NDUFAF3) (NM_199074) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH310699 NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951032) 10 ug
$3,255.00
PH317632 NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951033) 10 ug
$3,255.00
PH317754 NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951047) 10 ug
$3,255.00
LC404729 NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404730 NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404732 NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404733 NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404729 Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 1 100 ug
$436.00
LY404730 Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 2 100 ug
$436.00
LY404732 Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 3 100 ug
$436.00
LY404733 Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 4 100 ug
$436.00
TP302480 Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP310699 Recombinant protein of human chromosome 3 open reading frame 60 (C3orf60), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP317632 Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP317754 Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP318529 Recombinant protein of human chromosome 3 open reading frame 60 (C3orf60), transcript variant 5, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.