OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GRK6 (NM_001004106) Human Mass Spec Standard

Be the first to review this product
SKU
PH302464
GRK6 MS Standard C13 and N15-labeled recombinant protein (NP_001004106)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA326701 Rabbit Polyclonal GRK6 Antibody
100 ug
$640.00
LY419550 Transient overexpression lysate of G protein-coupled receptor kinase 6 (GRK6), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "GRK6 or NM_001004106"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202464
Predicted MW 65.8 kDa
Protein Sequence
Protein Sequence
>RC202464 representing NM_001004106
Red=Cloning site Green=Tags(s)

MELENIVANTVLLKAREGGGGNRKGKSKKWRQMLQFPHISQCEELRLSLERDYHSLCERQPIGRLLFREF
CATRPELSRCVAFLDGVAEYEVTPDDKRKACGRQLTQNFLSHTGPDLIPEVPRQLVTNCTQRLEQGPCKD
LFQELTRLTHEYLSVAPFADYLDSIYFNRFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRATGK
MYACKKLEKKRIKKRKGEAMALNEKQILEKVNSRFVVSLAYAYETKDALCLVLTLMNGGDLKFHIYHMGQ
AGFPEARAVFYAAEICCGLEDLHRERIVYRDLKPENILLDDHGHIRISDLGLAVHVPEGQTIKGRVGTVG
YMAPEVVKNERYTFSPDWWALGCLLYEMIAGQSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQARSLC
SQLLCKDPAERLGCRGGSAREVKEHPLFKKLNFKRLGAGMLEPPFKPDPQAIYCKDVLDIEQFSTVKGVE
LEPTDQDFYQKFATGSVPIPWQNEMVETECFQELNVFGLDGSVPPDLDWKGQPPAPPKKGLLQRLFSRQD
CCGNCSDSEEELPTRL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001004106
RefSeq Size 2930
RefSeq ORF 1728
Synonyms GPRK6
Locus ID 2870
UniProt ID P43250
Cytogenetics 5q35.3
Summary This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Chemokine signaling pathway, Endocytosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GRK6" proteins (5)
SKU Description Size Price
LC419550 Lyophilized GRK6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424064 Lyophilized GRK6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419550 Transient overexpression lysate of G protein-coupled receptor kinase 6 (GRK6), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY424064 Transient overexpression lysate of G protein-coupled receptor kinase 6 (GRK6), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302464 Recombinant protein of human G protein-coupled receptor kinase 6 (GRK6), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products