NUDT2 (NM_147172) Human Mass Spec Standard

CAT#: PH302439

NUDT2 MS Standard C13 and N15-labeled recombinant protein (NP_671701)

Product Images

Coomassie blue staining of purified NUDT2 protein (Cat# TP302439). The protein was produced from HEK293T cells transfected with NUDT2 cDNA clone (Cat# RC202439) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202439
• Predicted MW: 16.8 kDa
• Protein Sequence:
  Sequence Link

  >RC202439 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQL
  TIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQ
  FLCSIEA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_671701
• RefSeq Size: 1020
• RefSeq ORF: 441
• Synonyms: APAH1
• Locus ID: 318
• UniProt ID: P50583
• Cytogenetics: 9p13.3
• Summary: This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and four transcript variants, all encoding the same protein, have been identified. [provided by RefSeq, Sep 2011]
• Protein Pathways: Purine metabolism, Pyrimidine metabolism