OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VEGFB (NM_003377) Human Mass Spec Standard

Be the first to review this product
SKU
PH302426
VEGFB MS Standard C13 and N15-labeled recombinant protein (NP_003368)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA507205 VEGFB mouse monoclonal antibody, clone OTI1H9 (formerly 1H9) 100 ul
$447.00
LY418732 Transient overexpression lysate of vascular endothelial growth factor B (VEGFB) (as WB positive control) 100 ug
$436.00

Other products for "VEGFB or NM_003377"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202426
Predicted MW 21.6 kDa
Protein Sequence
Protein Sequence
>RC202426 protein sequence
Red=Cloning site Green=Tags(s)

MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVP
SCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDRAAT
PHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAPSTTSALTPGPAAAAADAAASSVAKGGA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003368
RefSeq Size 1822
RefSeq ORF 621
Synonyms VEGFL; VRF
Locus ID 7423
UniProt ID P49765
Cytogenetics 11q13.1
Summary This gene encodes a member of the PDGF (platelet-derived growth factor)/VEGF (vascular endothelial growth factor) family. The VEGF family members regulate the formation of blood vessels and are involved in endothelial cell physiology. This member is a ligand for VEGFR-1 (vascular endothelial growth factor receptor 1) and NRP-1 (neuropilin-1). Studies in mice showed that this gene was co-expressed with nuclear-encoded mitochondrial genes and the encoded protein specifically controlled endothelial uptake of fatty acids. Alternatively spliced transcript variants encoding distinct isoforms have been identified. provided by RefSeq, Sep 2011
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Bladder cancer, Cytokine-cytokine receptor interaction, Focal adhesion, mTOR signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VEGFB" proteins (3)
SKU Description Size Price
LC418732 Lyophilized VEGFB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418732 Transient overexpression lysate of vascular endothelial growth factor B (VEGFB) (as WB positive control) 100 ug
$436.00
TP302426 Recombinant protein of human vascular endothelial growth factor B (VEGFB), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products