OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KCNK6 (NM_004823) Human Mass Spec Standard

Be the first to review this product
SKU
PH302421
KCNK6 MS Standard C13 and N15-labeled recombinant protein (NP_004814)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA328631 Rabbit Polyclonal Anti-K2P6.1
50 ul
$1,145.00
LY401515 Transient overexpression lysate of potassium channel, subfamily K, member 6 (KCNK6) (as WB positive control) 100 ug
$436.00

Other products for "KCNK6 or NM_004823"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202421
Predicted MW 33.7 kDa
Protein Sequence
Protein Sequence
>RC202421 protein sequence
Red=Cloning site Green=Tags(s)

MRRGALLAGALAAYAAYLVLGALLVARLEGPHEARLRAELETLRAQLLQRSPCVAAPALDAFVERVLAAG
RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGKAFSIAFALLGVPTTMLLLTA
SAQRLSLLLTHVPLSWLSMRWGWDPRRAACWHLVALLGVVVTVCFLVPAVIFAHLEEAWSFLDAFYFCFI
SLSTIGLGDYVPGEAPGQPYRALYKVLVTVYLFLGLVAMVLVLQTFRHVSDLHGLTELILLPPPCPASFN
ADEDDRVDILGPQPESHQQLSASSHTDYASIPR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004814
RefSeq Size 2671
RefSeq ORF 939
Synonyms K2p6.1; KCNK8; TOSS; TWIK-2; TWIK2
Locus ID 9424
UniProt ID Q9Y257
Cytogenetics 19q13.2
Summary This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "KCNK6" proteins (3)
SKU Description Size Price
LC401515 Lyophilized KCNK6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401515 Transient overexpression lysate of potassium channel, subfamily K, member 6 (KCNK6) (as WB positive control) 100 ug
$436.00
TP302421 Recombinant protein of human potassium channel, subfamily K, member 6 (KCNK6), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products