SYNJ2BP (NM_018373) Human Mass Spec Standard

CAT#: PH302394

SYNJ2BP MS Standard C13 and N15-labeled recombinant protein (NP_060843)

Product Images

Coomassie blue staining of purified SYNJ2BP protein (Cat# TP302394). The protein was produced from HEK293T cells transfected with SYNJ2BP cDNA clone (Cat# RC202394) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202394
• Predicted MW: 15.9 kDa
• Protein Sequence:
  Sequence Link

  >RC202394 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNG
  QDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEGDPSGIPIFMVLVPVFALTMVAAWAFMR
  YRQQL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060843
• RefSeq Size: 7074
• RefSeq ORF: 435
• Synonyms: ARIP2; OMP25
• Locus ID: 55333
• UniProt ID: P57105, A0A024R670
• Cytogenetics: 14q24.2
• Summary: Regulates endocytosis of activin type 2 receptor kinases through the Ral/RALBP1-dependent pathway and may be involved in suppression of activin-induced signal transduction.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane