OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SYNJ2BP (NM_018373) Human Mass Spec Standard

Be the first to review this product
SKU
PH302394
SYNJ2BP MS Standard C13 and N15-labeled recombinant protein (NP_060843)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504051 SYNJ2BP mouse monoclonal antibody, clone OTI3A9 (formerly 3A9) 100 ul
$447.00
LY402678 Transient overexpression lysate of synaptojanin 2 binding protein (SYNJ2BP) (as WB positive control) 100 ug
$436.00

Other products for "SYNJ2BP or NM_018373"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202394
Predicted MW 15.9 kDa
Protein Sequence
Protein Sequence
>RC202394 protein sequence
Red=Cloning site Green=Tags(s)

MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNG
QDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEGDPSGIPIFMVLVPVFALTMVAAWAFMR
YRQQL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060843
RefSeq Size 7074
RefSeq ORF 435
Synonyms ARIP2; OMP25
Locus ID 55333
UniProt ID P57105
Cytogenetics 14q24.2
Summary Regulates endocytosis of activin type 2 receptor kinases through the Ral/RALBP1-dependent pathway and may be involved in suppression of activin-induced signal transduction.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SYNJ2BP" proteins (3)
SKU Description Size Price
LC402678 Lyophilized SYNJ2BP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402678 Transient overexpression lysate of synaptojanin 2 binding protein (SYNJ2BP) (as WB positive control) 100 ug
$436.00
TP302394 Recombinant protein of human synaptojanin 2 binding protein (SYNJ2BP), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products