SYNJ2BP (NM_018373) Human Recombinant Protein

SKU
TP302394
Recombinant protein of human synaptojanin 2 binding protein (SYNJ2BP), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202394 protein sequence
Red=Cloning site Green=Tags(s)

MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNG
QDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEGDPSGIPIFMVLVPVFALTMVAAWAFMR
YRQQL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 15.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060843
Locus ID 55333
UniProt ID P57105
Cytogenetics 14q24.2
RefSeq Size 7074
RefSeq ORF 435
Synonyms ARIP2; OMP25
Summary Regulates endocytosis of activin type 2 receptor kinases through the Ral/RALBP1-dependent pathway and may be involved in suppression of activin-induced signal transduction.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:SYNJ2BP (NM_018373) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302394 SYNJ2BP MS Standard C13 and N15-labeled recombinant protein (NP_060843) 10 ug
$3,255.00
LC402678 SYNJ2BP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402678 Transient overexpression lysate of synaptojanin 2 binding protein (SYNJ2BP) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.