GLTP (NM_016433) Human Mass Spec Standard

CAT#: PH302383

GLTP MS Standard C13 and N15-labeled recombinant protein (NP_057517)

Product Images

Coomassie blue staining of purified GLTP protein (Cat# TP302383). The protein was produced from HEK293T cells transfected with GLTP cDNA clone (Cat# RC202383) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202383
• Predicted MW: 23.8 kDa
• Protein Sequence:
  Sequence Link

  >RC202383 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALLAEHLLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTNPAKFRTL
  QNILEVEKEMYGAEWPKVGATLALMWLKRGLRFIQVFLQSICDGERDENHPNLIRVNATKAYEMALKKYH
  GWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDVIYEMYTQMNAELNYKV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057517
• RefSeq Size: 2371
• RefSeq ORF: 627
• Locus ID: 51228
• UniProt ID: Q9NZD2, A0A024RBI7
• Cytogenetics: 12q24.11
• Summary: The protein encoded by this gene is similar to bovine and porcine proteins which accelerate transfer of certain glycosphingolipids and glyceroglycolipids between membranes. It is thought to be a cytoplasmic protein. [provided by RefSeq, Jul 2008]