OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ELMOD2 (NM_153702) Human Mass Spec Standard

Be the first to review this product
SKU
PH302343
ELMOD2 MS Standard C13 and N15-labeled recombinant protein (NP_714913)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA330947 Rabbit polyclonal Anti-ELMOD2 Antibody
100 ul
$585.00
LY406969 Transient overexpression lysate of ELMO/CED-12 domain containing 2 (ELMOD2) (as WB positive control) 100 ug
$436.00

Other products for "ELMOD2 or NM_153702"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202343
Predicted MW 35 kDa
Protein Sequence
Protein Sequence
>RC202343 protein sequence
Red=Cloning site Green=Tags(s)

MFISLWEFFYGHFFRFWMKWLLRQMTGKCELQRIFDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEV
DKYVDDIMKEKNINPEKDASFKICMKMCLLQITGYKQLYLDVESVRKRPYDSDNLQHEELLMKLWNLLMP
TKKLNARISKQWAEIGFQGDDPKTDFRGMGILGLINLVYFSENYTSEAHQILSRSNHPKLGYSYAIVGIN
LTEMAYSLLKSEALKFHLYNLVPGIPTMEHFHQFYCYLVYEFDKFWFEEEPESIMYFNLYREKFHEKIKG
LLLDCNVALTLKV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_714913
RefSeq Size 4425
RefSeq ORF 879
Synonyms 9830169G11Rik
Locus ID 255520
UniProt ID Q8IZ81
Cytogenetics 4q31.1
Summary This gene encodes one of six engulfment and motility (ELMO) domain-containing proteins. This gene is thought to play a role in antiviral responses. Mutations in this gene may be involved in the cause of familial idiopathic pulmonary fibrosis. provided by RefSeq, Sep 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ELMOD2" proteins (3)
SKU Description Size Price
LC406969 Lyophilized ELMOD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406969 Transient overexpression lysate of ELMO/CED-12 domain containing 2 (ELMOD2) (as WB positive control) 100 ug
$436.00
TP302343 Recombinant protein of human ELMO/CED-12 domain containing 2 (ELMOD2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products