OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MAGEH1 (NM_014061) Human Mass Spec Standard

Be the first to review this product
SKU
PH302331
MAGEH1 MS Standard C13 and N15-labeled recombinant protein (NP_054780)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA378208 MAGEH1 Rabbit polyclonal Antibody
100 ul
$410.00
LY415504 Transient overexpression lysate of melanoma antigen family H, 1 (MAGEH1) (as WB positive control) 100 ug
$436.00

Other products for "MAGEH1 or NM_014061"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202331
Predicted MW 24.4 kDa
Protein Sequence
Protein Sequence
>RC202331 protein sequence
Red=Cloning site Green=Tags(s)

MPRGRKSRRRRNARAAEENRNNRKIQASEASETPMAASVVASTPEDDLSGPEEDPSTPEEASTTPEEASS
TAQAQKPSVPRSNFQGTKKSLLMSILALIFIMGNSAKEALVWKVLGKLGMQPGRQHSIFGDPKKIVTEEF
VRRGYLIYKPVPRSSPVEYEFFWGPRAHVESSKLKVMHFVARVRNRCSKDWPCNYDWDSDDDAEVEAILN
SGARGYSAP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054780
RefSeq Size 1485
RefSeq ORF 657
Synonyms APR-1; APR1; MAGEH
Locus ID 28986
UniProt ID Q9H213
Cytogenetics Xp11.21
Summary This gene belongs to the non-CT (non cancer/testis) subgroup of the melanoma-associated antigen (MAGE) superfamily. The encoded protein is likely associated with apoptosis, cell cycle arrest, growth inhibition or cell differentiation. The protein may be involved in the atRA (all-trans retinoic acid) signaling through the STAT1-alpha (signal transducer and activator of transcription 1-alpha) pathway. provided by RefSeq, Aug 2013
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MAGEH1" proteins (3)
SKU Description Size Price
LC415504 Lyophilized MAGEH1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415504 Transient overexpression lysate of melanoma antigen family H, 1 (MAGEH1) (as WB positive control) 100 ug
$436.00
TP302331 Recombinant protein of human melanoma antigen family H, 1 (MAGEH1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products