OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EDC3 (NM_025083) Human Mass Spec Standard

Be the first to review this product
SKU
PH302321
EDC3 MS Standard C13 and N15-labeled recombinant protein (NP_079359)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308155 Rabbit Polyclonal antibody to Edc3 (enhancer of mRNA decapping 3 homolog (S. cerevisiae))
100 ul
$665.00
LY410908 Transient overexpression lysate of enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "EDC3 or NM_025083"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202321
Predicted MW 56.1 kDa
Protein Sequence
Protein Sequence
>RC202321 protein sequence
Red=Cloning site Green=Tags(s)

MATDWLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVPEVTFRAGDITELKILEIPGP
GDNQHFGDLHQTELGPSGAGCQVGINQNGTGKFVKKPASSSSAPQNIPKRTDVKSQDVAVSPQQQQCSKS
YVDRHMESLSQSKSFRRRHNSWSSSSRHPNQATPKKSGLKNGQMKNKDDECFGDDIEEIPDTDFDFEGNL
ALFDKAAVFEEIDTYERRSGTRSRGIPNERPTRYRHDENILESEPIVYRRIIVPHNVSKEFCTDSGLVVP
SISYELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPNRLNPKNVHQRPTVALLCGPHVKGAQG
ISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCLDCPENVFLR
DQPWYKAAVAWANQNRAPVLSIDPPVHEVEQGIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVG
INYHSPFGCKFVIPLHSA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079359
RefSeq Size 3781
RefSeq ORF 1524
Synonyms hYjeF_N2-15q23; LSM16; MRT50; YJDC; YJEFN2
Locus ID 80153
UniProt ID Q96F86
Cytogenetics 15q24.1
Summary This gene encodes a protein that is important in mRNA degradation. The encoded protein is a component of a decapping complex that promotes efficient removal of the monomethylguanosine (m7G) cap from mRNAs, as part of the 5' to 3' mRNA decay pathway. Mutations in this gene have been identified in human patients with an autosomal recessive form of intellectual disability. provided by RefSeq, May 2017
Protein Pathways RNA degradation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EDC3" proteins (11)
SKU Description Size Price
PH326857 EDC3 MS Standard C13 and N15-labeled recombinant protein (NP_001135915) 10 ug
$3,360.00
PH327114 EDC3 MS Standard C13 and N15-labeled recombinant protein (NP_001135916) 10 ug
$3,360.00
LC410908 Lyophilized EDC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428097 Lyophilized EDC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428098 Lyophilized EDC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410908 Transient overexpression lysate of enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY428097 Transient overexpression lysate of enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428098 Transient overexpression lysate of enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302321 Recombinant protein of human enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 3, 20 µg 20 ug
$737.00
TP326857 Recombinant protein of human enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 1, 20 µg 20 ug
$737.00
TP327114 Recombinant protein of human enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products