OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LRTOMT (NM_145309) Human Mass Spec Standard

Be the first to review this product
SKU
PH302297
LRTOMT MS Standard C13 and N15-labeled recombinant protein (NP_660352)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA329762 Rabbit polyclonal Anti-LRRC51 Antibody
100 ul
$585.00
LY407958 Transient overexpression lysate of leucine rich transmembrane and 0-methyltransferase domain containing (LRTOMT), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "LRRC51 or NM_145309"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202297
Predicted MW 22.2 kDa
Protein Sequence
Protein Sequence
>RC202297 protein sequence
Red=Cloning site Green=Tags(s)

MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQV
ASQLLEHPENLAWIDLSFNDLTSIDPVLTTFFNLSVLYLHGNSIQRLGEVNKLAVLPRLRSLTLHGNPME
EEKGYRQYVLCTLSRITTFDFSGVTKADRTTAEVWKRMNIKPKKAWTKQNTL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_660352
RefSeq Size 2658
RefSeq ORF 576
Locus ID 220074
UniProt ID Q96E66
Cytogenetics 11q13.4
Summary This locus represents naturally occurring readthrough transcription between the neighboring LRRC51 (leucine-rich repeat containing 51) and TOMT (transmembrane O-methyltransferase) genes on chromosome 11. The readthrough transcript encodes a fusion protein that shares sequence identity with each individual gene product. Multiple reports implicate mutations in this gene in nonsyndromic deafness.provided by RefSeq, Feb 2021
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LRRC51" proteins (7)
SKU Description Size Price
LC407958 Lyophilized LRTOMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428810 Lyophilized LRTOMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428811 Lyophilized LRTOMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407958 Transient overexpression lysate of leucine rich transmembrane and 0-methyltransferase domain containing (LRTOMT), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428810 Transient overexpression lysate of leucine rich transmembrane and 0-methyltransferase domain containing (LRTOMT), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428811 Transient overexpression lysate of leucine rich transmembrane and 0-methyltransferase domain containing (LRTOMT), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP302297 Recombinant protein of human leucine rich transmembrane and 0-methyltransferase domain containing (LRTOMT), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products