ACY3 (NM_080658) Human Mass Spec Standard

CAT#: PH302287

ACY3 MS Standard C13 and N15-labeled recombinant protein (NP_542389)

Product Images

Coomassie blue staining of purified ACY3 protein (Cat# TP302287). The protein was produced from HEK293T cells transfected with ACY3 cDNA clone (Cat# RC202287) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202287
• Predicted MW: 35.2 kDa
• Protein Sequence:
  Sequence Link

  >RC202287 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MCSLPVPREPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVPVLANPAATSGCRRYVDHDLN
  RTFTSSFLNSRPTPDDPYEVTRARELNQLLGPKASGQAFDFVLDLHNTTANMGTCLIAKSSHEVFAMHLC
  RHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGLGLELGPQPQGVLRADIFSRMRTLVATVLDFIELFN
  QGTAFPAFEMEAYRPVGVVDFPRTEAGHLAGTVHPQLQDRDFQPLQPGAPIFQMFSGEDLLYEGESTVYP
  VFINEAAYYEKGVAFVQTEKFTFTVPAMPALTPAPSPAS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_542389
• RefSeq Size: 1317
• RefSeq ORF: 957
• Synonyms: ACY-3; HCBP1
• Locus ID: 91703
• UniProt ID: Q96HD9, A0A024R5L2
• Cytogenetics: 11q13.2
• Summary: Plays an important role in deacetylating mercapturic acids in kidney proximal tubules. Also acts on N-acetyl-aromatic amino acids (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Alanine, aspartate and glutamate metabolism, Histidine metabolism