EID2B (NM_152361) Human Mass Spec Standard

CAT#: PH302251

EID2B MS Standard C13 and N15-labeled recombinant protein (NP_689574)

Product Images

Coomassie blue staining of purified EID2B protein (Cat# TP302251). The protein was produced from HEK293T cells transfected with EID2B cDNA clone (Cat# RC202251) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202251
• Predicted MW: 17 kDa
• Protein Sequence:
  Sequence Link

  >RC202251 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEPTGLLEMSELPGDSSVPQVGTASGVSDVLRGAVGGGVRVQEAREGPVAEAARSMARMPGPVPGPIPS
  SVPGLASAPDPHQQLAFLEINRQLLFREYLDGSSMIPVRLLRDFEERRRLFVEGCKAREAAFDADPPQMD
  FAAVAFTVALTASEALSPLAD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689574
• RefSeq Size: 1865
• RefSeq ORF: 483
• Synonyms: EID-2B; EID-3
• Locus ID: 126272
• UniProt ID: Q96D98
• Cytogenetics: 19q13.2
• Summary: Acts as a repressor of MYOD-dependent transcription, glucocorticoid receptor-dependent transcription, and muscle differentiation.[UniProtKB/Swiss-Prot Function]