OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MCFD2 (NM_139279) Human Mass Spec Standard

Be the first to review this product
SKU
PH302230
MCFD2 MS Standard C13 and N15-labeled recombinant protein (NP_644808)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA366109 MCFD2 rabbit polyclonal antibody
100 ul
$310.00
LY408335 Transient overexpression lysate of multiple coagulation factor deficiency 2 (MCFD2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "MCFD2 or NM_139279"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202230
Predicted MW 16.4 kDa
Protein Sequence
Protein Sequence
>RC202230 protein sequence
Red=Cloning site Green=Tags(s)

MTMRSLLRTPFLCGLLWAFCAPGARAEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQ
ELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAE
FAKSLQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_644808
RefSeq Size 4196
RefSeq ORF 438
Synonyms F5F8D; F5F8D2; LMAN1IP; SDNSF
Locus ID 90411
UniProt ID Q8NI22
Cytogenetics 2p21
Summary This gene encodes a soluble luminal protein with two calmodulin-like EF-hand motifs at its C-terminus. This protein forms a complex with LMAN1 (lectin mannose binding protein 1; also known as ERGIC-53) that facilitates the transport of coagulation factors V (FV) and VIII (FVIII) from the endoplasmic reticulum to the Golgi apparatus via an endoplasmic reticulum Golgi intermediate compartment (ERGIC). Mutations in this gene cause combined deficiency of FV and FVIII (F5F8D); a rare autosomal recessive bleeding disorder characterized by mild to moderate bleeding and coordinate reduction in plasma FV and FVIII levels. This protein has also been shown to maintain stem cell potential in adult central nervous system and is a marker for testicular germ cell tumors. The 3' UTR of this gene contains a transposon-like human repeat element named 'THE 1'. A processed RNA pseudogene of this gene is on chromosome 6p22.1. Alternative splicing results in multiple transcript variants encoding distinct isoforms. provided by RefSeq, Apr 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MCFD2" proteins (3)
SKU Description Size Price
LC408335 Lyophilized MCFD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408335 Transient overexpression lysate of multiple coagulation factor deficiency 2 (MCFD2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302230 Recombinant protein of human multiple coagulation factor deficiency 2 (MCFD2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products