TRAPPC4 (NM_016146) Human Mass Spec Standard

CAT#: PH302213

TRAPPC4 MS Standard C13 and N15-labeled recombinant protein (NP_057230)

Product Images

Coomassie blue staining of purified TRAPPC4 protein (Cat# TP302213). The protein was produced from HEK293T cells transfected with TRAPPC4 cDNA clone (Cat# RC202213) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202213
• Predicted MW: 24.3 kDa
• Protein Sequence:
  Sequence Link

  >RC202213 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMD
  VNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETD
  TFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAE
  KAGTFGPGS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057230
• RefSeq Size: 1216
• RefSeq ORF: 657
• Synonyms: CGI-104; HSPC172; NEDESBA; PTD009; SBDN; SYNBINDIN; TRS23
• Locus ID: 51399
• UniProt ID: Q9Y296
• Cytogenetics: 11q23.3
• Summary: May play a role in vesicular transport from endoplasmic reticulum to Golgi.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome