OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VAT1 (NM_006373) Human Mass Spec Standard

Be the first to review this product
SKU
PH302201
VAT1 MS Standard C13 and N15-labeled recombinant protein (NP_006364)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA383200 VAT1 Rabbit polyclonal Antibody
100 ul
$475.00
LY401915 Transient overexpression lysate of vesicle amine transport protein 1 homolog (T. californica) (VAT1) (as WB positive control) 100 ug
$436.00

Other products for "VAT1 or NM_006373"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202201
Predicted MW 41.9 kDa
Protein Sequence
Protein Sequence
>RC202201 protein sequence
Red=Cloning site Green=Tags(s)

MSDEREVAEAATGEDASSPPPKTEAASDPQHPAASEGAAAAAASPPLLRCLVLTGFGGYDKVKLQSRPAA
PPAPGPGQLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMEGAGVVIAVGEGVSDRKAGDRVMVLNRS
GMWQEEVTVPSVQTFLIPEAMTFEEAAALLVNYITAYMVLFDFGNLQPGHSVLVHMAAGGVGMAAVQLCR
TVENVTVFGTASASKHEALKENGVTHPIDYHTTDYVDEIKKISPKGVDIVMDPLGGSDTAKGYNLLKPMG
KVVTYGMANLLTGPKRNLMALARTWWNQFSVTALQLLQANRAVCGFHLGYLDGEVELVSGVVARLLALYN
QGHIKPHIDSVWPFEKVADAMKQMQEKKNVGKVLLVPGPEKEN

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006364
RefSeq Size 2758
RefSeq ORF 1179
Synonyms VATI
Locus ID 10493
UniProt ID Q99536
Cytogenetics 17q21.31
Summary Synaptic vesicles are responsible for regulating the storage and release of neurotransmitters in the nerve terminal. The protein encoded by this gene is an abundant integral membrane protein of cholinergic synaptic vesicles and is thought to be involved in vesicular transport. It belongs to the quinone oxidoreductase subfamily of zinc-containing alcohol dehydrogenase proteins. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VAT1" proteins (3)
SKU Description Size Price
LC401915 Lyophilized VAT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401915 Transient overexpression lysate of vesicle amine transport protein 1 homolog (T. californica) (VAT1) (as WB positive control) 100 ug
$436.00
TP302201 Recombinant protein of human vesicle amine transport protein 1 homolog (T. californica) (VAT1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products