OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SH3KBP1 (NM_031892) Human Mass Spec Standard

Be the first to review this product
SKU
PH302186
SH3KBP1 MS Standard C13 and N15-labeled recombinant protein (NP_114098)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350412 Rabbit Polyclonal Anti-SH3KBP1 rabbit polyclonal antibody
100 ul
$205.00
LY410454 Transient overexpression lysate of SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SH3KBP1 or NM_031892"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202186
Predicted MW 72.9 kDa
Protein Sequence
Protein Sequence
>RC202186 representing NM_031892
Red=Cloning site Green=Tags(s)

MVEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKEMKKDPLTNKAP
EKPLHEVPSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVL
NGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEGANGTVATAAIQPKKV
KGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEA
QNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQ
GAGTTERKHEIKKIPPERPEMLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLSRPGALPPR
RPERPVGPLTHTRGDSPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSHPTTSRPKATGRR
PPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVTISQVSDNKASLPPKPGTMAAGG
GGPAPLSSAVPSPLSSSLGTAGHRANSPSLFGTEGKPKMEPAASSQAAVEELRTQVRELRSIIETMKDQQ
KREIKQLLSELDEEKKIRLRLQMEVNDIKKALQSK

TRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_114098
RefSeq Size 3348
RefSeq ORF 1995
Synonyms AGMX2; CD2BP3; CIN85; GIG10; HSB-1; HSB1; IMD61; MIG18
Locus ID 30011
UniProt ID Q96B97
Cytogenetics Xp22.12
Summary This gene encodes an adapter protein that contains one or more N-terminal Src homology domains, a proline rich region and a C-terminal coiled-coil domain. The encoded protein facilitates protein-protein interactions and has been implicated in numerous cellular processes including apoptosis, cytoskeletal rearrangement, cell adhesion and in the regulation of clathrin-dependent endocytosis. Alternate splicing results in multiple transcript variants encoding distinct isoforms. provided by RefSeq, Jul 2017
Protein Families Druggable Genome
Protein Pathways Endocytosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SH3KBP1" proteins (7)
SKU Description Size Price
PH315701 SH3KBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001019837) 10 ug
$3,360.00
LC410454 Lyophilized SH3KBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422529 Lyophilized SH3KBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410454 Transient overexpression lysate of SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422529 Transient overexpression lysate of SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP302186 Recombinant protein of human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 1, 20 µg 20 ug
$867.00
TP315701 Recombinant protein of human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products