SH3KBP1 (NM_001024666) Human Mass Spec Standard

SKU
PH315701
SH3KBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001019837)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215701]
Predicted MW 68.4 kDa
Protein Sequence
Protein Sequence
>RC215701 representing NM_001024666
Red=Cloning site Green=Tags(s)

MEVSAAKAPSAADLSEIEIKKEMKKDPLTNKAPEKPLHEVPSGNSLLSSETILRTNKRGERRRRRCQVAF
SYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRE
TTGSESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKK
LPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGV
FPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQGAGTTERKHEIKKIPPERPEMLPNRTEEKERPEREPK
LDLQKPSVPAIPPKKPRPPKTNSLSRPGALPPRRPERPVGPLTHTRGDSPKIDLAGSSLSGILDKDLSDR
SNDIDLEGFDSVVSSTEKLSHPTTSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGV
DASKKTSKTVTISQVSDNKASLPPKPGTMAAGGGGPAPLSSAAPSPLSSSLGTAGHRANSPSLFGTEGKP
KMEPAASSQAAVEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRLRLQMEVNDIKKALQSK

TRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001019837
RefSeq Size 2689
RefSeq ORF 1884
Synonyms AGMX2; CD2BP3; CIN85; GIG10; HSB-1; HSB1; IMD61; MIG18
Locus ID 30011
UniProt ID Q96B97
Cytogenetics Xp22.12
Summary This gene encodes an adapter protein that contains one or more N-terminal Src homology domains, a proline rich region and a C-terminal coiled-coil domain. The encoded protein facilitates protein-protein interactions and has been implicated in numerous cellular processes including apoptosis, cytoskeletal rearrangement, cell adhesion and in the regulation of clathrin-dependent endocytosis. Alternate splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2017]
Protein Families Druggable Genome
Protein Pathways Endocytosis
Write Your Own Review
You're reviewing:SH3KBP1 (NM_001024666) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH302186 SH3KBP1 MS Standard C13 and N15-labeled recombinant protein (NP_114098) 10 ug
$3,255.00
LC410454 SH3KBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422529 SH3KBP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410454 Transient overexpression lysate of SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 1 100 ug
$436.00
LY422529 Transient overexpression lysate of SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 2 100 ug
$665.00
TP302186 Recombinant protein of human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP315701 Recombinant protein of human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.