OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FKBPL (NM_022110) Human Mass Spec Standard

Be the first to review this product
SKU
PH302153
FKBPL MS Standard C13 and N15-labeled recombinant protein (NP_071393)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502165 FKBPL mouse monoclonal antibody, clone OTI2D8 (formerly 2D8) 100 ul
$447.00
LY411782 Transient overexpression lysate of FK506 binding protein like (FKBPL) (as WB positive control) 100 ug
$436.00

Other products for "FKBPL or NM_022110"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202153
Predicted MW 38.2 kDa
Protein Sequence
Protein Sequence
>RC202153 protein sequence
Red=Cloning site Green=Tags(s)

METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELEVSPDPASQILEHTQGAEKLV
AELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKLGSCCRVLALGFPFGSGPPEG
WTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGHSGPPVRLTLASFTQGRDSWELETSEKEALA
REERARGTELFRAGNPEGAARCYGRALRLLLTLPPPGPPERTVLHANLAACQLLLGQPQLAAQSCDRVLE
REPGHLKALYRRGVAQAALGNLEKATADLKKVLAIDPKNRAAQEELGKVVIQGKNQDAGLAQGLRKMFG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071393
RefSeq Size 1357
RefSeq ORF 1047
Synonyms DIR1; NG7; WISP39
Locus ID 63943
UniProt ID Q9UIM3
Cytogenetics 6p21.32
Summary The protein encoded by this gene has similarity to the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The encoded protein is thought to have a potential role in the induced radioresistance. Also it appears to have some involvement in the control of the cell cycle. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FKBPL" proteins (3)
SKU Description Size Price
LC411782 Lyophilized FKBPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411782 Transient overexpression lysate of FK506 binding protein like (FKBPL) (as WB positive control) 100 ug
$436.00
TP302153 Recombinant protein of human FK506 binding protein like (FKBPL), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products