OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CPSF7 (NM_024811) Human Mass Spec Standard

Be the first to review this product
SKU
PH302127
CPSF7 MS Standard C13 and N15-labeled recombinant protein (NP_079087)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA343932 Rabbit Polyclonal Anti-FLJ12529 Antibody
100 ul
$525.00
LY411065 Transient overexpression lysate of cleavage and polyadenylation specific factor 7, 59kDa (CPSF7), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CPSF7 or NM_024811"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202127
Predicted MW 52.1 kDa
Protein Sequence
Protein Sequence
>RC202127 protein sequence
Red=Cloning site Green=Tags(s)

MSEGVDLIDIYADEEFNQDPEFNNTDQIDLYDDVLTATSQPSDDRSSSTEPPPPVRQEPSPKPNNKTPAI
LYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRANGQSKGYAEVVVASENSVHK
LLELLPGKVLNGEKVDVRPATRQNLSQFEAQARKRECVRVPRGGIPPRAHSRDSSDSADGRATPSENLVP
SSARVDKPPSVLPYFNRPPSALPLMGLPPPPIPPPPPLSSSFGVPPPPPGIHYQHLMPPPPRLPPHLAVP
PPGAIPPALHLNPAFFPPPNATVGPPPDTYMKASAPYNHHGSRDSGPPPSTVSEAEFEDIMKRNRAISSS
AISKAVSGASAGDYSDAIETLLTAIAVIKQSRVANDERCRVLISSLKDCLHGIEAKSYSVGASGSSSRKR
HRSRERSPSRSRESSRRHRDLLHNEDRHDDYFQERNREHERHRDRERDRHH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079087
RefSeq Size 3764
RefSeq ORF 1413
Synonyms CFIm59
Locus ID 79869
UniProt ID Q8N684
Cytogenetics 11q12.2
Summary Cleavage factor Im (CFIm) is one of six factors necessary for correct cleavage and polyadenylation of pre-mRNAs. CFIm is composed of three different subunits of 25, 59, and 68 kDa, and it functions as a heterotetramer, with a dimer of the 25 kDa subunit binding to two of the 59 or 68 kDa subunits. The protein encoded by this gene represents the 59 kDa subunit, which can interact with the splicing factor U2 snRNP Auxiliary Factor (U2AF) 65 to link the splicing and polyadenylation complexes. provided by RefSeq, Oct 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CPSF7" proteins (5)
SKU Description Size Price
LC411065 Lyophilized CPSF7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427787 Lyophilized CPSF7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411065 Transient overexpression lysate of cleavage and polyadenylation specific factor 7, 59kDa (CPSF7), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427787 Transient overexpression lysate of cleavage and polyadenylation specific factor 7, 59kDa (CPSF7), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302127 Recombinant protein of human pre-mRNA cleavage factor I, 59 kDa subunit (FLJ12529), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products