OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C19orf21 (MISP) (NM_173481) Human Mass Spec Standard

Be the first to review this product
SKU
PH302091
C19orf21 MS Standard C13 and N15-labeled recombinant protein (NP_775752)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA337787 Rabbit Polyclonal Anti-MISP Antibody
100 ul
$585.00
LY406598 Transient overexpression lysate of chromosome 19 open reading frame 21 (C19orf21) (as WB positive control) 100 ug
$436.00

Other products for "C19orf21 or NM_173481"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202091
Predicted MW 75.4 kDa
Protein Sequence
Protein Sequence
>RC202091 protein sequence
Red=Cloning site Green=Tags(s)

MDRVTRYPILGIPQAHRGTGLVLDGDTSYTYHLVCMGPEASGWGQDEPQTWPTDHRAQQGVQRQGVSYSV
HAYTGQPSPRGLHSENREDEGWQVYRLGARDAHQGRPTWALRPEDGEDKEMKTYRLDAGDADPRRLCDLE
RERWAVIQGQAVRKSSTVATLQGTPDHGDPRTPGPPRSTPLEENVVDREQIDFLAARQQFLSLEQANKGA
PHSSPARGTPAGTTPGASQAPKAFNKPHLANGHVVPIKPQVKGVVREENKVRAVPTWASVQVVDDPGSLA
SVESPGTPKETPIEREIRLAQEREADLREQRGLRQATDHQELVEIPTRPLLTKLSLITAPRRERGRPSLY
VQRDIVQETQREEDHRREGLHVGRASTPDWVSEGPQPGLRRALSSDSILSPAPDARAADPAPEVRKVNRI
PPDAYQPYLSPGTPQLEFSAFGAFGKPSSLSTAEAKAATSPKATMSPRHLSESSGKPLSTKQEASKPPRG
CPQANRGVVRWEYFRLRPLRFRAPDEPQQAQVPHVWGWEVAGAPALRLQKSQSSDLLERERESVLRREQE
VAEERRNALFPEVFSPTPDENSDQNSRSSSQASGITGSYSVSESPFFSPIHLHSNVAWTVEDPVDSAPPG
QRKKEQWYAGINPSDGINSEVLEAIRVTRHKNAMAERWESRIYASEEDD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_775752
RefSeq Size 2907
RefSeq ORF 2037
Synonyms C19orf21; MISP1
Locus ID 126353
UniProt ID Q8IVT2
Cytogenetics 19p13.3
Summary The protein encoded by this gene is an actin-bundling protein involved in determining cell morphology and mitotic progression. The encoded protein is required for the proper positioning of the mitotic spindle. Two transcript variants, one protein-coding and the other non-protein coding, have been found for this gene. provided by RefSeq, Feb 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C19orf21" proteins (3)
SKU Description Size Price
LC406598 Lyophilized MISP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406598 Transient overexpression lysate of chromosome 19 open reading frame 21 (C19orf21) (as WB positive control) 100 ug
$436.00
TP302091 Recombinant protein of human chromosome 19 open reading frame 21 (C19orf21), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products