OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

uPA (PLAU) (NM_002658) Human Mass Spec Standard

Be the first to review this product
SKU
PH302083
PLAU MS Standard C13 and N15-labeled recombinant protein (NP_002649)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA805243 PLAU mouse monoclonal antibody, clone OTI5H4 (formerly 5H4) 100 ul
$447.00
LY400942 Transient overexpression lysate of plasminogen activator, urokinase (PLAU), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "uPA or NM_002658"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202083
Predicted MW 48.5 kDa
Protein Sequence
Protein Sequence
>RC202083 protein sequence
Red=Cloning site Green=Tags(s)

MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTC
YEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLK
PLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCG
GSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLK
IRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHY
YGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR
SHTKEENGLAL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002649
RefSeq Size 2395
RefSeq ORF 1293
Synonyms ATF; BDPLT5; QPD; u-PA; UPA; URK
Locus ID 5328
UniProt ID P00749
Cytogenetics 10q22.2
Summary This gene encodes a secreted serine protease that converts plasminogen to plasmin. The encoded preproprotein is proteolytically processed to generate A and B polypeptide chains. These chains associate via a single disulfide bond to form the catalytically inactive high molecular weight urokinase-type plasminogen activator (HMW-uPA). HMW-uPA can be further processed into the catalytically active low molecular weight urokinase-type plasminogen activator (LMW-uPA). This low molecular weight form does not bind to the urokinase-type plasminogen activator receptor. Mutations in this gene may be associated with Quebec platelet disorder and late-onset Alzheimer's disease. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. provided by RefSeq, Jan 2016
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Protease
Protein Pathways Complement and coagulation cascades
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "uPA" proteins (4)
SKU Description Size Price
LC400942 Lyophilized PLAU HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400942 Transient overexpression lysate of plasminogen activator, urokinase (PLAU), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302083 Recombinant protein of human plasminogen activator, urokinase (PLAU), transcript variant 1, 20 µg 20 ug
$737.00
TP720654 Purified recombinant protein of Human plasminogen activator, urokinase (PLAU), transcript variant 1 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products