ID1 (NM_002165) Human Mass Spec Standard
CAT#: PH302061
ID1 MS Standard C13 and N15-labeled recombinant protein (NP_002156)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202061 |
Predicted MW | 16.1 kDa |
Protein Sequence |
>RC202061 protein sequence
Red=Cloning site Green=Tags(s) MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMN GCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALT AEAACVPADDRILCR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002156 |
RefSeq Size | 1000 |
RefSeq ORF | 465 |
Synonyms | bHLHb24; ID |
Locus ID | 3397 |
UniProt ID | P41134 |
Cytogenetics | 20q11.21 |
Summary | The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | TGF-beta signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400785 | ID1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC405746 | ID1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400785 | Transient overexpression lysate of inhibitor of DNA binding 1, dominant negative helix-loop-helix protein (ID1), transcript variant 1 |
USD 436.00 |
|
LY405746 | Transient overexpression lysate of inhibitor of DNA binding 1, dominant negative helix-loop-helix protein (ID1), transcript variant 2 |
USD 436.00 |
|
TP302061 | Recombinant protein of human inhibitor of DNA binding 1, dominant negative helix-loop-helix protein (ID1), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review