OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AGR2 (NM_006408) Human Mass Spec Standard

Be the first to review this product
SKU
PH302023
AGR2 MS Standard C13 and N15-labeled recombinant protein (NP_006399)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA809754 AGR2 mouse monoclonal antibody,clone OTI3F2 100 ul
$447.00
LY416668 Transient overexpression lysate of anterior gradient homolog 2 (Xenopus laevis) (AGR2) (as WB positive control) 100 ug
$436.00

Other products for "AGR2 or NM_006408"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202023
Predicted MW 19.8 kDa
Protein Sequence
Protein Sequence
>RC202023 representing NM_006408
Red=Cloning site Green=Tags(s)

MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNK
PLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRAD
ITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006399
RefSeq Size 1701
RefSeq ORF 525
Synonyms AG-2; AG2; GOB-4; HAG-2; HEL-S-116; HPC8; PDIA17; XAG-2
Locus ID 10551
UniProt ID O95994
Cytogenetics 7p21.1
Summary This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and a C-terminal ER-retention sequence. This protein plays a role in cell migration, cellular transformation and metastasis and is as a p53 inhibitor. As an ER-localized molecular chaperone, it plays a role in the folding, trafficking, and assembly of cysteine-rich transmembrane receptors and the cysteine-rich intestinal gylcoprotein mucin. This gene has been implicated in inflammatory bowel disease and cancer progression. provided by RefSeq, Mar 2017
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "AGR2" proteins (4)
SKU Description Size Price
LC416668 Lyophilized AGR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416668 Transient overexpression lysate of anterior gradient homolog 2 (Xenopus laevis) (AGR2) (as WB positive control) 100 ug
$436.00
TP302023 Recombinant protein of human anterior gradient homolog 2 (Xenopus laevis) (AGR2), 20 µg 20 ug
$867.00
TP720358 Recombinant protein of human anterior gradient homolog 2 (Xenopus laevis) (AGR2) 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products