AGR2 (NM_006408) Human Tagged ORF Clone

SKU
RC202023
AGR2 (Myc-DDK-tagged)-Human anterior gradient homolog 2 (Xenopus laevis) (AGR2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Target Symbol AGR2
Synonyms AG-2; AG2; GOB-4; HAG-2; HEL-S-116; HPC8; PDIA17; XAG-2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202023 representing NM_006408
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAAAATTCCAGTGTCAGCATTCTTGCTCCTTGTGGCCCTCTCCTACACTCTGGCCAGAGATACCA
CAGTCAAACCTGGAGCCAAAAAGGACACAAAGGACTCTCGACCCAAACTGCCCCAGACCCTCTCCAGAGG
TTGGGGTGACCAACTCATCTGGACTCAGACATATGAAGAAGCTCTATATAAATCCAAGACAAGCAACAAA
CCCTTGATGATTATTCATCACTTGGATGAGTGCCCACACAGTCAAGCTTTAAAGAAAGTGTTTGCTGAAA
ATAAAGAAATCCAGAAATTGGCAGAGCAGTTTGTCCTCCTCAATCTGGTTTATGAAACAACTGACAAACA
CCTTTCTCCTGATGGCCAGTATGTCCCCAGGATTATGTTTGTTGACCCATCTCTGACAGTTAGAGCCGAT
ATCACTGGAAGATATTCAAACCGTCTCTATGCTTACGAACCTGCAGATACAGCTCTGTTGCTTGACAACA
TGAAGAAAGCTCTCAAGTTGCTGAAGACTGAATTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202023 representing NM_006408
Red=Cloning site Green=Tags(s)

MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNK
PLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRAD
ITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006408
ORF Size 525 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006408.4
RefSeq Size 1701 bp
RefSeq ORF 528 bp
Locus ID 10551
UniProt ID O95994
Cytogenetics 7p21.1
Protein Families Secreted Protein
MW 19.8 kDa
Summary This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and a C-terminal ER-retention sequence. This protein plays a role in cell migration, cellular transformation and metastasis and is as a p53 inhibitor. As an ER-localized molecular chaperone, it plays a role in the folding, trafficking, and assembly of cysteine-rich transmembrane receptors and the cysteine-rich intestinal gylcoprotein mucin. This gene has been implicated in inflammatory bowel disease and cancer progression. [provided by RefSeq, Mar 2017]
Write Your Own Review
You're reviewing:AGR2 (NM_006408) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202023L1 Lenti ORF clone of Human anterior gradient homolog 2 (Xenopus laevis) (AGR2), Myc-DDK-tagged 10 ug
$600.00
RC202023L2 Lenti ORF clone of Human anterior gradient homolog 2 (Xenopus laevis) (AGR2), mGFP tagged 10 ug
$600.00
RC202023L3 Lenti ORF clone of Human anterior gradient homolog 2 (Xenopus laevis) (AGR2), Myc-DDK-tagged 10 ug
$600.00
RC202023L4 Lenti ORF clone of Human anterior gradient homolog 2 (Xenopus laevis) (AGR2), mGFP tagged 10 ug
$600.00
RG202023 AGR2 (tGFP-tagged) - Human anterior gradient homolog 2 (Xenopus laevis) (AGR2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC116098 AGR2 (untagged)-Human anterior gradient homolog 2 (Xenopus laevis) (AGR2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.