OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PGRMC1 (NM_006667) Human Mass Spec Standard

Be the first to review this product
SKU
PH301918
PGRMC1 MS Standard C13 and N15-labeled recombinant protein (NP_006658)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA369269 PGRMC1 rabbit polyclonal antibody
100 ul
$310.00
LY401994 Transient overexpression lysate of progesterone receptor membrane component 1 (PGRMC1) (as WB positive control) 100 ug
$436.00

Other products for "PGRMC1 or NM_006667"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201918
Predicted MW 21.7 kDa
Protein Sequence
Protein Sequence
>RC201918 protein sequence
Red=Cloning site Green=Tags(s)

MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDDEPPPLPRLKR
RDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYD
DLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006658
RefSeq Size 1931
RefSeq ORF 585
Synonyms Dap1; HPR6.6; IZA; MPR
Locus ID 10857
UniProt ID O00264
Cytogenetics Xq24
Summary This gene encodes a putative membrane-associated progesterone steroid receptor. The protein is expressed predominantly in the liver and kidney. provided by RefSeq, Mar 2010
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PGRMC1" proteins (3)
SKU Description Size Price
LC401994 Lyophilized PGRMC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401994 Transient overexpression lysate of progesterone receptor membrane component 1 (PGRMC1) (as WB positive control) 100 ug
$436.00
TP301918 Recombinant protein of human progesterone receptor membrane component 1 (PGRMC1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products