OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C19orf53 (NM_014047) Human Mass Spec Standard

Be the first to review this product
SKU
PH301879
C19orf53 MS Standard C13 and N15-labeled recombinant protein (NP_054766)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY415508 Transient overexpression lysate of chromosome 19 open reading frame 53 (C19orf53) (as WB positive control) 100 ug
$436.00

Other products for "C19orf53 or NM_014047"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201879
Predicted MW 10.6 kDa
Protein Sequence
Protein Sequence
>RC201879 protein sequence
Red=Cloning site Green=Tags(s)

MAQGQRKFQAHKPAKSKTAAAASEKNRGPRKGGRVIAPKKARVVQQQKLKKNLEVGIRKKIEHDVVMKAS
SSLPKKLALLKAPAKKKGAAAATSSKTPS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054766
RefSeq Size 934
RefSeq ORF 297
Synonyms HSPC023; LYDG10
Locus ID 28974
UniProt ID Q9UNZ5
Cytogenetics 19p13.13
Summary May have a potential role in hypercalcemia of malignancy.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C19orf53" proteins (3)
SKU Description Size Price
LC415508 Lyophilized C19orf53 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415508 Transient overexpression lysate of chromosome 19 open reading frame 53 (C19orf53) (as WB positive control) 100 ug
$436.00
TP301879 Recombinant protein of human chromosome 19 open reading frame 53 (C19orf53), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products