OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NAP1L1 (NM_139207) Human Mass Spec Standard

Be the first to review this product
SKU
PH301851
NAP1L1 MS Standard C13 and N15-labeled recombinant protein (NP_631946)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA322733 Anti-NAP1L1 Rabbit Polyclonal Antibody
100 ul
$305.00
LY417929 Transient overexpression lysate of nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "NAP1L1 or NM_139207"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201851
Predicted MW 45.4 kDa
Protein Sequence
Protein Sequence
>RC201851 protein sequence
Red=Cloning site Green=Tags(s)

MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESL
PRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEED
EISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPM
SFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHK
GRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDD
DDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_631946
RefSeq Size 4451
RefSeq ORF 1173
Synonyms NAP1; NAP1L; NRP
Locus ID 4673
UniProt ID P55209
Cytogenetics 12q21.2
Summary This gene encodes a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms; however, not all have been fully described. provided by RefSeq, Apr 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NAP1L1" proteins (7)
SKU Description Size Price
PH320821 NAP1L1 MS Standard C13 and N15-labeled recombinant protein (NP_004528) 10 ug
$3,360.00
LC408353 Lyophilized NAP1L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417929 Lyophilized NAP1L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408353 Transient overexpression lysate of nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY417929 Transient overexpression lysate of nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP301851 Recombinant protein of human nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 1, 20 µg 20 ug
$867.00
TP320821 Recombinant protein of human nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products