NAP1L1 (NM_004537) Human Mass Spec Standard

SKU
PH320821
NAP1L1 MS Standard C13 and N15-labeled recombinant protein (NP_004528)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220821]
Predicted MW 45.2 kDa
Protein Sequence
Protein Sequence
>RC220821 representing NM_004537
Red=Cloning site Green=Tags(s)

MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESL
PRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEED
EISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPM
SFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHK
GRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDD
DDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004528
RefSeq Size 2908
RefSeq ORF 1173
Synonyms NAP1; NAP1L; NRP
Locus ID 4673
UniProt ID P55209
Cytogenetics 12q21.2
Summary This gene encodes a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms; however, not all have been fully described. [provided by RefSeq, Apr 2015]
Write Your Own Review
You're reviewing:NAP1L1 (NM_004537) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301851 NAP1L1 MS Standard C13 and N15-labeled recombinant protein (NP_631946) 10 ug
$3,255.00
LC408353 NAP1L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417929 NAP1L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408353 Transient overexpression lysate of nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 1 100 ug
$436.00
LY417929 Transient overexpression lysate of nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 2 100 ug
$436.00
TP301851 Recombinant protein of human nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP320821 Recombinant protein of human nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.