OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DAK (TKFC) (NM_015533) Human Mass Spec Standard

Be the first to review this product
SKU
PH301724
DAK MS Standard C13 and N15-labeled recombinant protein (NP_056348)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365719 TKFC rabbit polyclonal antibody
100 ul
$310.00
LY414482 Transient overexpression lysate of dihydroxyacetone kinase 2 homolog (S. cerevisiae) (DAK) (as WB positive control) 100 ug
$436.00

Other products for "DAK or NM_015533"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201724
Predicted MW 58.9 kDa
Protein Sequence
Protein Sequence
>RC201724 protein sequence
Red=Cloning site Green=Tags(s)

MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVALLSGGGSGHEPAHAGFIGKG
MLTGVIAGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGLAREQARAEGIPVEMVVIGDD
SAFTVLKKAGRRGLCGTVLIHKVAGALAEAGVGLEEIAKQVNVVAKAMGTLGVSLSSCSVPGSKPTFELS
ADEVELGLGIHGEAGVRRIKMATADEIVKLMLDHMTNTTNASHVPVQPGSSVVMMVNNLGGLSFLELGII
ADATVRSLEGRGVKIARALVGTFMSALEMPGISLTLLLVDEPLLKLIDAETTAAAWPNVAAVSITGRKRS
RVAPAEPQEAPDSTAAGGSASKRMALVLERVCSTLLGLEEHLNALDRAAGDGDCGTTHSRAARAIQEWLK
EGPPPASPAQLLSKLSVLLLEKMGGSSGALYGLFLTAAAQPLKAKTSLPAWSAAMDAGLEAMQKYGKAAP
GDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAAAEATKNMEAGAGRASYISSARLEQPDPGAV
AAAAILRAILEVLQS

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056348
RefSeq Size 4248
RefSeq ORF 1725
Synonyms DAK; NET45; TKFCD
Locus ID 26007
UniProt ID Q3LXA3
Cytogenetics 11q12.2
Summary This gene is a member of the family of dihydroxyacetone kinases, which have a protein structure distinct from other kinases. The product of this gene phosphorylates dihydroxyacetone, and also catalyzes the formation of riboflavin 4',5'-phosphate (aka cyclin FMN) from FAD. Several alternatively spliced transcript variants have been found for this gene. provided by RefSeq, Jun 2017
Protein Families Druggable Genome
Protein Pathways Glycerolipid metabolism, Metabolic pathways, RIG-I-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DAK" proteins (3)
SKU Description Size Price
LC414482 Lyophilized TKFC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414482 Transient overexpression lysate of dihydroxyacetone kinase 2 homolog (S. cerevisiae) (DAK) (as WB positive control) 100 ug
$436.00
TP301724 Recombinant protein of human dihydroxyacetone kinase 2 homolog (S. cerevisiae) (DAK), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products