CMBL (NM_138809) Human Mass Spec Standard

CAT#: PH301711

CMBL MS Standard C13 and N15-labeled recombinant protein (NP_620164)

Product Images

Coomassie blue staining of purified CMBL protein (Cat# TP301711). The protein was produced from HEK293T cells transfected with CMBL cDNA clone (Cat# RC201711) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201711
• Predicted MW: 28 kDa
• Protein Sequence:
  Sequence Link

  >RC201711 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MANEAYPCPCDIGHRLEYGGLGREVQVEHIKAYVTKSPVDAGKAVIVIQDIFGWQLPNTRYIADMISGNG
  YTTIVPDFFVGQEPWDPSGDWSIFPEWLKTRNAQKIDREISAILKYLKQQCHAQKIGIVGFCWGGTAVHH
  LMMKYSEFRAGVSVYGIVKDSEDIYNLKNPTLFIFAENDVVIPLKDVSLLTQKLKEHCKVEYQIKTFSGQ
  THGFVHRKREDCSPADKPYIDEARRNLIEWLNKYM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_620164
• RefSeq Size: 4047
• RefSeq ORF: 735
• Synonyms: JS-1
• Locus ID: 134147
• UniProt ID: Q96DG6
• Cytogenetics: 5p15.2
• Summary: CMBL (EC 3.1.1.45) is a cysteine hydrolase of the dienelactone hydrolase family that is highly expressed in liver cytosol. CMBL preferentially cleaves cyclic esters, and it activates medoxomil-ester prodrugs in which the medoxomil moiety is linked to an oxygen atom (Ishizuka et al., 2010 [PubMed 20177059]).[supplied by OMIM, Apr 2010]
• Protein Pathways: Metabolic pathways