OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TTC1 (NM_003314) Human Mass Spec Standard

Be the first to review this product
SKU
PH301690
TTC1 MS Standard C13 and N15-labeled recombinant protein (NP_003305)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA307951 Rabbit polyclonal antibody to TTC1 (tetratricopeptide repeat domain 1)
100 ul
$665.00
LY418776 Transient overexpression lysate of tetratricopeptide repeat domain 1 (TTC1) (as WB positive control) 100 ug
$436.00

Other products for "TTC1 or NM_003314"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201690
Predicted MW 33.5 kDa
Protein Sequence
Protein Sequence
>RC201690 protein sequence
Red=Cloning site Green=Tags(s)

MGEKSENCGVPEDLLNGLKVTDTQEAECAGPPVPDPKNQHSQSKLLRDDEAHLQEDQGEEECFHDCSASF
EEEPGADKVENKSNEDVNSSELDEEYLIELKKNMSDEEKQKRREESTRLKEEGNEQFKKGDYIEAESSYS
RALEMCPSCFQKERSILFSNRAAARMKQDKKEMAINDCSKAIQLNPSYIRAILRRAELYEKTDKLDEALE
DYKSILEKDPSIHQAREACMRLPKQIEERNERLKEEMLGKLKDLGNLVLRPFGLSTENFQIKQDSSTGSY
SINFVQNPNNNR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003305
RefSeq Size 1500
RefSeq ORF 876
Synonyms TPR1
Locus ID 7265
UniProt ID Q99614
Cytogenetics 5q33.3
Summary This gene encodes a protein that belongs to the tetratrico peptide repeat superfamily of proteins. The encoded protein plays a role in protein-protein interactions, and binds to the Galpha subunit of G protein-coupled receptors to activate the Ras signaling pathway. Alternate splicing results in multiple transcript variants. provided by RefSeq, Sep 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TTC1" proteins (3)
SKU Description Size Price
LC418776 Lyophilized TTC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418776 Transient overexpression lysate of tetratricopeptide repeat domain 1 (TTC1) (as WB positive control) 100 ug
$436.00
TP301690 Recombinant protein of human tetratricopeptide repeat domain 1 (TTC1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products