OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CEP72 (NM_018140) Human Mass Spec Standard

Be the first to review this product
SKU
PH301663
CEP72 MS Standard C13 and N15-labeled recombinant protein (NP_060610)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811145 CEP72 mouse monoclonal antibody,clone OTI4D2 100 ul
$447.00
LY413293 Transient overexpression lysate of centrosomal protein 72kDa (CEP72) (as WB positive control) 100 ug
$436.00

Other products for "CEP72 or NM_018140"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201663
Predicted MW 71.7 kDa
Protein Sequence
Protein Sequence
>RC201663 protein sequence
Red=Cloning site Green=Tags(s)

MARAGPRLVLSEEAVRAKSGLGPHRDLAELQSLSIPGTYQEKITHLGHSLMSLTGLKSLDLSRNSLVSLE
GIQYLTALESLNLYYNCISSLAEVFRLHALTELVDVDFRLNPVVKVEPDYRLFVVHLLPKLQQLDDRPVR
ASERKASRLHFASEDSLDSKESVPASLKEGRPHHPRAKCTEALAKQSLVMDADDEAVLNLIAECEWDLGR
PPGSTSFSQKGREADSRGSQESRHLLSPQLVQYQCGDSGKQGRETRRSSCRGCCLEKMPWSQLCGELPPL
YGAEPEASRAPRPHTYFTPHPDSMDTEDSASSQKLDLSGEMVPGPLPAPGKCRKRRMPVGRFQTFSDQEG
LGCPERTHGSSVPKESLSRQDSSESRNGRTLSQPEASETEEQRSRGVTDTREPSPGSHSALPGKKTALQA
ALLETLLDLVDRSWGGCRSLHSNEAFLAQARHILSSVEEFTAAQDSSAMVGEDVGSLALESKSLQSRLAE
QQQQHAREMSEVTAELHHTHKELDDLRQHLDKSLEENSRLKSLLLSMKKEVKSADTAATLNLQIAGLQTS
VKRLCGEIVELKQHLEHYDKIQELTQMLQESHSSLVSTNEHLLQELSQVRAQHRAEVEQMHWSYQELKKT
MALFPHSSASHGGCQAC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060610
RefSeq Size 2427
RefSeq ORF 1941
Locus ID 55722
UniProt ID Q9P209
Cytogenetics 5p15.33
Summary The product of this gene is a member of the leucine-rich-repeat (LRR) superfamily of proteins. The protein is localized to the centrosome, a non-membraneous organelle that functions as the major microtubule-organizing center in animal cells. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CEP72" proteins (4)
SKU Description Size Price
LC413293 Lyophilized CEP72 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413293 Transient overexpression lysate of centrosomal protein 72kDa (CEP72) (as WB positive control) 100 ug
$436.00
TP301663 Recombinant protein of human centrosomal protein 72kDa (CEP72), 20 µg 20 ug
$867.00
TP761372 Purified recombinant protein ofHuman centrosomal protein 72kDa (CEP72), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products