OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FKBP2 (NM_057092) Human Mass Spec Standard

Be the first to review this product
SKU
PH301608
FKBP2 MS Standard C13 and N15-labeled recombinant protein (NP_476433)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344329 Rabbit Polyclonal Anti-FKBP2 Antibody - N-terminal region
100 ul
$585.00
LY401423 Transient overexpression lysate of FK506 binding protein 2, 13kDa (FKBP2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "FKBP2 or NM_057092"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201608
Predicted MW 15.6 kDa
Protein Sequence
Protein Sequence
>RC201608 protein sequence
Red=Cloning site Green=Tags(s)

MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSL
PQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRT
EL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_476433
RefSeq Size 653
RefSeq ORF 426
Synonyms FKBP-13; FKBP13; PPIase
Locus ID 2286
UniProt ID P26885
Cytogenetics 11q13.1
Summary The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple alternatively spliced variants, encoding the same protein, have been identified. provided by RefSeq, Sep 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FKBP2" proteins (12)
SKU Description Size Price
PH310573 FKBP2 MS Standard C13 and N15-labeled recombinant protein (NP_004461) 10 ug
$3,360.00
PH325120 FKBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001128680) 10 ug
$3,360.00
LC401423 Lyophilized FKBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403297 Lyophilized FKBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427591 Lyophilized FKBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401423 Transient overexpression lysate of FK506 binding protein 2, 13kDa (FKBP2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY403297 Transient overexpression lysate of FK506 binding protein 2, 13kDa (FKBP2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427591 Transient overexpression lysate of FK506 binding protein 2, 13kDa (FKBP2), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP301608 Recombinant protein of human FK506 binding protein 2, 13kDa (FKBP2), transcript variant 2, 20 µg 20 ug
$867.00
TP310573 Recombinant protein of human FK506 binding protein 2, 13kDa (FKBP2), transcript variant 1, 20 µg 20 ug
$867.00
TP325120 Recombinant protein of human FK506 binding protein 2, 13kDa (FKBP2), transcript variant 3, 20 µg 20 ug
$867.00
TP721091 Purified recombinant protein of Human FK506 binding protein 2, 13kDa (FKBP2), transcript variant 2 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products