FKBP2 (NM_057092) Human Recombinant Protein

SKU
TP301608
Recombinant protein of human FK506 binding protein 2, 13kDa (FKBP2), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201608 protein sequence
Red=Cloning site Green=Tags(s)

MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSL
PQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRT
EL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 13.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_476433
Locus ID 2286
UniProt ID P26885
Cytogenetics 11q13.1
RefSeq Size 653
RefSeq ORF 426
Synonyms FKBP-13; FKBP13; PPIase
Summary The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Sep 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:FKBP2 (NM_057092) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301608 FKBP2 MS Standard C13 and N15-labeled recombinant protein (NP_476433) 10 ug
$3,255.00
PH310573 FKBP2 MS Standard C13 and N15-labeled recombinant protein (NP_004461) 10 ug
$3,255.00
PH325120 FKBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001128680) 10 ug
$3,255.00
LC401423 FKBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC403297 FKBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427591 FKBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401423 Transient overexpression lysate of FK506 binding protein 2, 13kDa (FKBP2), transcript variant 1 100 ug
$436.00
LY403297 Transient overexpression lysate of FK506 binding protein 2, 13kDa (FKBP2), transcript variant 2 100 ug
$436.00
LY427591 Transient overexpression lysate of FK506 binding protein 2, 13kDa (FKBP2), transcript variant 3 100 ug
$436.00
TP310573 Recombinant protein of human FK506 binding protein 2, 13kDa (FKBP2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP325120 Recombinant protein of human FK506 binding protein 2, 13kDa (FKBP2), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP721091 Purified recombinant protein of Human FK506 binding protein 2, 13kDa (FKBP2), transcript variant 2 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.