RAB13 (NM_002870) Human Mass Spec Standard

CAT#: PH301555

RAB13 MS Standard C13 and N15-labeled recombinant protein (NP_002861)

Product Images

Coomassie blue staining of purified RAB13 protein (Cat# TP301555). The protein was produced from HEK293T cells transfected with RAB13 cDNA clone (Cat# RC201555) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201555
• Predicted MW: 22.8 kDa
• Protein Sequence:
  Sequence Link

  >RC201555 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERF
  KTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLA
  REHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKKNTNKCSLG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002861
• RefSeq Size: 1235
• RefSeq ORF: 609
• Synonyms: GIG4
• Locus ID: 5872
• UniProt ID: P51153, Q504R6
• Cytogenetics: 1q21.3
• Summary: This gene is a member of the Rab family of small G proteins and plays a role in regulating membrane trafficking between trans-Golgi network (TGN) and recycling endosomes (RE). The encoded protein is involved in the assembly of tight junctions, which are components of the apical junctional complex (AJC) of epithelial cells. The AJC plays a role in forming a barrier between luminal contents and the underlying tissue. Additional functions associated with the protein include endocytic recycling of occludin, regulation of epithelial cell scattering, neuronal regeneration and regulation of neurite outgrowth. Alternately spliced transcript variants have been observed for this gene. A pseudogene associated with this gene is located on chromosome 12. [provided by RefSeq, Jan 2013]
• Protein Families: Druggable Genome
• Protein Pathways: Tight junction