OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PPIH (NM_006347) Human Mass Spec Standard

Be the first to review this product
SKU
PH301529
PPIH MS Standard C13 and N15-labeled recombinant protein (NP_006338)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA803474 PPIH mouse monoclonal antibody, clone OTI1C6 (formerly 1C6) 100 ul
$447.00
LY416702 Transient overexpression lysate of peptidylprolyl isomerase H (cyclophilin H) (PPIH) (as WB positive control) 100 ug
$436.00

Other products for "PPIH or NM_006347"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201529
Predicted MW 19.2 kDa
Protein Sequence
Protein Sequence
>RC201529 protein sequence
Red=Cloning site Green=Tags(s)

MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIK
DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVV
FGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006338
RefSeq Size 813
RefSeq ORF 531
Synonyms CYP-20; CYPH; SnuCyp-20; USA-CYP
Locus ID 10465
UniProt ID O43447
Cytogenetics 1p34.2
Summary The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome. provided by RefSeq, Jul 2008
Protein Pathways Spliceosome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PPIH" proteins (4)
SKU Description Size Price
LC416702 Lyophilized PPIH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416702 Transient overexpression lysate of peptidylprolyl isomerase H (cyclophilin H) (PPIH) (as WB positive control) 100 ug
$436.00
TP301529 Recombinant protein of human peptidylprolyl isomerase H (cyclophilin H) (PPIH), 20 µg 20 ug
$867.00
TP720226 Recombinant protein of human peptidylprolyl isomerase H (cyclophilin H) (PPIH) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products