OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GAS41 (YEATS4) (NM_006530) Human Mass Spec Standard

Be the first to review this product
SKU
PH301526
YEATS4 MS Standard C13 and N15-labeled recombinant protein (NP_006521)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA383407 YEATS4 Rabbit polyclonal Antibody
100 ul
$410.00
LY401956 Transient overexpression lysate of YEATS domain containing 4 (YEATS4) (as WB positive control) 100 ug
$436.00

Other products for "GAS41 or NM_006530"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201526
Predicted MW 26.5 kDa
Protein Sequence
Protein Sequence
>RC201526 protein sequence
Red=Cloning site Green=Tags(s)

MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKL
HESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYD
EMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINC
LKNEIRKLEEDDQAKDI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006521
RefSeq Size 1509
RefSeq ORF 681
Synonyms 4930573H17Rik; B230215M10Rik; GAS41; NUBI-1; YAF9
Locus ID 8089
UniProt ID O95619
Cytogenetics 12q15
Summary The protein encoded by this gene is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors. Alternative splicing results in multiple transcript variants encoding different isoforms. provided by RefSeq, Jul 2014
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GAS41" proteins (3)
SKU Description Size Price
LC401956 Lyophilized YEATS4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401956 Transient overexpression lysate of YEATS domain containing 4 (YEATS4) (as WB positive control) 100 ug
$436.00
TP301526 Purified recombinant protein of Homo sapiens YEATS domain containing 4 (YEATS4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products