GAS41 (YEATS4) (NM_006530) Human Tagged ORF Clone

SKU
RC201526
YEATS4 (Myc-DDK-tagged)-Human YEATS domain containing 4 (YEATS4)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GAS41
Synonyms 4930573H17Rik; B230215M10Rik; GAS41; NUBI-1; YAF9
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201526 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCAAGAGAATGGCCGAATTTGGGCCTGACTCCGGCGGGAGAGTAAAGGGTGTTACTATCGTTAAAC
CAATAGTTTACGGTAATGTTGCTCGGTATTTTGGAAAGAAAAGAGAAGAAGATGGGCACACTCATCAGTG
GACAGTATATGTGAAACCATATAGAAATGAGGATATGTCAGCATATGTGAAGAAAATCCAGTTTAAATTA
CATGAAAGCTATGGCAATCCTTTAAGAGTTGTTACTAAACCTCCATATGAAATTACTGAAACAGGATGGG
GTGAATTCGAAATAATCATCAAAATATTTTTCATTGACCCTAATGAAAGACCTGTAACCCTGTATCATTT
GCTAAAGCTGTTTCAATCAGACACCAATGCAATGCTGGGGAAAAAGACAGTGGTTTCAGAGTTCTATGAT
GAAATGATATTTCAAGACCCAACAGCAATGATGCAACAATTATTGACAACATCTCGTCAGCTAACATTAG
GAGCCTATAAGCATGAAACAGAATTTGCAGAGCTTGAAGTGAAAACCAGAGAAAAATTAGAAGCTGCTAA
GAAAAAAACAAGCTTTGAGATTGCAGAGCTTAAGGAGAGATTAAAAGCAAGTCGTGAAACTATAAATTGT
TTAAAAAATGAAATCAGAAAACTTGAAGAAGATGACCAAGCAAAAGACATA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201526 protein sequence
Red=Cloning site Green=Tags(s)

MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKL
HESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYD
EMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINC
LKNEIRKLEEDDQAKDI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006530
ORF Size 681 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006530.4
RefSeq Size 1509 bp
RefSeq ORF 684 bp
Locus ID 8089
UniProt ID O95619
Cytogenetics 12q15
Domains YEATS
Protein Families Druggable Genome, Transcription Factors
MW 26.5 kDa
Summary The protein encoded by this gene is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2014]
Write Your Own Review
You're reviewing:GAS41 (YEATS4) (NM_006530) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201526L1 Lenti ORF clone of Human YEATS domain containing 4 (YEATS4), Myc-DDK-tagged 10 ug
$600.00
RC201526L2 Lenti ORF clone of Human YEATS domain containing 4 (YEATS4), mGFP tagged 10 ug
$600.00
RC201526L3 Lenti ORF clone of Human YEATS domain containing 4 (YEATS4), Myc-DDK-tagged 10 ug
$600.00
RC201526L4 Lenti ORF clone of Human YEATS domain containing 4 (YEATS4), mGFP tagged 10 ug
$600.00
RG201526 YEATS4 (tGFP-tagged) - Human YEATS domain containing 4 (YEATS4) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC116019 YEATS4 (untagged)-Human YEATS domain containing 4 (YEATS4) 10 ug
$300.00
SC322161 YEATS4 (untagged)-Human YEATS domain containing 4 (YEATS4) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.