OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DYNLT3 (NM_006520) Human Mass Spec Standard

Be the first to review this product
SKU
PH301525
DYNLT3 MS Standard C13 and N15-labeled recombinant protein (NP_006511)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY416586 Transient overexpression lysate of dynein, light chain, Tctex-type 3 (DYNLT3) (as WB positive control) 100 ug
$436.00

Other products for "DYNLT3 or NM_006520"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201525
Predicted MW 13.1 kDa
Protein Sequence
Protein Sequence
>RC201525 protein sequence
Red=Cloning site Green=Tags(s)

MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAV
VQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006511
RefSeq Size 2230
RefSeq ORF 348
Synonyms RP3; TCTE1L; TCTEX1L
Locus ID 6990
UniProt ID P51808
Cytogenetics Xp11.4
Summary This gene encodes a member of a subclass of dynein light chains. The encoded protein homodimerizes and forms the light chain component of the cytoplasmic dynein motor protein complex. This protein may be important for binding dynein to specific cargos including the spindle checkpoint protein BUB3. This protein may also function independently of dynein as a transcriptional modulator. Pseudogenes of this gene are found on chromosomes 2 and 20.provided by RefSeq, Mar 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DYNLT3" proteins (3)
SKU Description Size Price
LC416586 Lyophilized DYNLT3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416586 Transient overexpression lysate of dynein, light chain, Tctex-type 3 (DYNLT3) (as WB positive control) 100 ug
$436.00
TP301525 Recombinant protein of human dynein, light chain, Tctex-type 3 (DYNLT3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products