OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FAM174C (NM_017914) Human Mass Spec Standard

Be the first to review this product
SKU
PH301498
C19orf24 MS Standard C13 and N15-labeled recombinant protein (NP_060384)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA343864 Rabbit Polyclonal Anti-C19orf24 Antibody
100 ul
$585.00
LY413443 Transient overexpression lysate of chromosome 19 open reading frame 24 (C19orf24) (as WB positive control) 100 ug
$436.00

Other products for "FAM174C or NM_017914"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201498
Predicted MW 14.1 kDa
Protein Sequence
Protein Sequence
>RC201498 representing NM_017914
Red=Cloning site Green=Tags(s)

MREGQEMGPTPVPSNPLLHRSFPCWPRGWSHPVPTRELLLEPAQPADLLPPAPTAGPCSLASWMLSQPGR
GSQVKTGGTPTATAQDAEAPLPDCDLCLSPAPVGTWQPRAKAGWAGDPRNLSGNTFSPGWEQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060384
RefSeq Size 886
RefSeq ORF 396
Synonyms C19orf24
Locus ID 55009
UniProt ID Q9BVV8
Cytogenetics 19p13.3
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FAM174C" proteins (3)
SKU Description Size Price
LC413443 Lyophilized C19orf24 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413443 Transient overexpression lysate of chromosome 19 open reading frame 24 (C19orf24) (as WB positive control) 100 ug
$436.00
TP301498 Recombinant protein of human chromosome 19 open reading frame 24 (C19orf24), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products