RAB10 (NM_016131) Human Mass Spec Standard
CAT#: PH301464
RAB10 MS Standard C13 and N15-labeled recombinant protein (NP_057215)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201464 |
Predicted MW | 22.5 kDa |
Protein Sequence |
>RC201464 protein sequence
Red=Cloning site Green=Tags(s) MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQER FHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQI AREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057215 |
RefSeq Size | 3785 |
RefSeq ORF | 600 |
Locus ID | 10890 |
UniProt ID | P61026 |
Cytogenetics | 2p23.3 |
Summary | RAB10 belongs to the RAS (see HRAS; MIM 190020) superfamily of small GTPases. RAB proteins localize to exocytic and endocytic compartments and regulate intracellular vesicle trafficking (Bao et al., 1998 [PubMed 9918381]).[supplied by OMIM, Mar 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414160 | RAB10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414160 | Transient overexpression lysate of RAB10, member RAS oncogene family (RAB10) |
USD 436.00 |
|
TP301464 | Recombinant protein of human RAB10, member RAS oncogene family (RAB10), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review