SFXN2 (NM_178858) Human Mass Spec Standard

CAT#: PH301408

SFXN2 MS Standard C13 and N15-labeled recombinant protein (NP_849189)

Product Images

Coomassie blue staining of purified SFXN2 protein (Cat# TP301408). The protein was produced from HEK293T cells transfected with SFXN2 cDNA clone (Cat# RC201408) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201408
• Predicted MW: 36.2 kDa
• Protein Sequence:
  Sequence Link

  >RC201408 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEADLSGFNIDAPRWDQRTFLGRVKHFLNITDPRTVFVSERELDWAKVMVEKSRMGVVPPGTQVEQLLYA
  KKLYDSAFHPDTGEKMNVIGRMSFQLPGGMIITGFMLQFYRTMPAVIFWQWVNQSFNALVNYTNRNAASP
  TSVRQMALSYFTATTTAVATAVGMNMLTKKAPPLVGRWVPFAAVAAANCVNIPMMRQQELIKGICVKDRN
  ENEIGHSRRAAAIGITQVVISRITMSAPGMILLPVIMERLEKLHFMQKVKVLHAPLQVMLSGCFLIFMVP
  VACGLFPQKCELPVSYLEPKLQDTIKAKYGELEPYVYFNKGL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_849189
• RefSeq Size: 2562
• RefSeq ORF: 966
• Synonyms: SLC56A2
• Locus ID: 118980
• UniProt ID: Q96NB2
• Cytogenetics: 10q24.32
• Summary: Mitochondrial amino-acid transporter that mediates transport of serine into mitochondria.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane