OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GADD45G (NM_006705) Human Mass Spec Standard

Be the first to review this product
SKU
PH301364
GADD45G MS Standard C13 and N15-labeled recombinant protein (NP_006696)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505437 GADD45G mouse monoclonal antibody, clone OTI2F12 (formerly 2F12) 100 ul
$447.00
LY416476 Transient overexpression lysate of growth arrest and DNA-damage-inducible, gamma (GADD45G) (as WB positive control) 100 ug
$436.00

Other products for "GADD45G or NM_006705"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201364
Predicted MW 17.1 kDa
Protein Sequence
Protein Sequence
>RC201364 protein sequence
Red=Cloning site Green=Tags(s)

MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEG
DIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSL
FCEESRSVNDWVPSITLPE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006696
RefSeq Size 1087
RefSeq ORF 477
Synonyms CR6; DDIT2; GADD45gamma; GRP17
Locus ID 10912
UniProt ID O95257
Cytogenetics 9q22.2
Summary This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta. provided by RefSeq, Jul 2008
Protein Pathways Cell cycle, MAPK signaling pathway, p53 signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GADD45G" proteins (4)
SKU Description Size Price
LC416476 Lyophilized GADD45G HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416476 Transient overexpression lysate of growth arrest and DNA-damage-inducible, gamma (GADD45G) (as WB positive control) 100 ug
$436.00
TP301364 Recombinant protein of human growth arrest and DNA-damage-inducible, gamma (GADD45G), 20 µg 20 ug
$867.00
TP720527 Recombinant protein of human growth arrest and DNA-damage-inducible, gamma (GADD45G) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products