GADD45G (NM_006705) Human Mass Spec Standard

SKU PH301364

GADD45G MS Standard C13 and N15-labeled recombinant protein (NP_006696)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC201364]
• Predicted MW: 17.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC201364 protein sequence; Red=Cloning site Green=Tags(s); ; MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEG; DIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSL; FCEESRSVNDWVPSITLPE; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_006696
• RefSeq Size: 1087
• RefSeq ORF: 477
• Synonyms: CR6; DDIT2; GADD45gamma; GRP17
• Locus ID: 10912
• UniProt ID: O95257
• Cytogenetics: 9q22.2
• Summary: This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta. [provided by RefSeq, Jul 2008]
• Protein Pathways: Cell cycle, MAPK signaling pathway, p53 signaling pathway