GADD45G (NM_006705) Human Tagged ORF Clone
SKU
RC201364
GADD45G (Myc-DDK-tagged)-Human growth arrest and DNA-damage-inducible, gamma (GADD45G)
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | GADD45G |
Synonyms | CR6; DDIT2; GADD45gamma; GRP17 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC201364 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACTCTGGAAGAAGTCCGCGGCCAGGACACAGTTCCGGAAAGCACAGCCAGGATGCAGGGTGCCGGGA AAGCGCTGCATGAGTTGCTGCTGTCGGCGCAGCGTCAGGGCTGCCTCACTGCCGGCGTCTACGAGTCAGC CAAAGTCTTGAACGTGGACCCCGACAATGTGACCTTCTGTGTGCTGGCTGCGGGTGAGGAGGACGAGGGC GACATCGCGCTGCAGATCCATTTTACGCTGATCCAGGCTTTCTGCTGCGAGAACGACATCGACATAGTGC GCGTGGGCGATGTGCAGCGGCTGGCGGCTATCGTGGGCGCCGGCGAGGAGGCGGGTGCGCCGGGCGACCT GCACTGCATCCTCATTTCGAACCCCAACGAGGACGCCTGGAAGGATCCCGCCTTGGAGAAGCTCAGCCTG TTTTGCGAGGAGAGCCGCAGCGTTAACGACTGGGTGCCCAGCATCACCCTCCCCGAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201364 protein sequence
Red=Cloning site Green=Tags(s) MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEG DIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSL FCEESRSVNDWVPSITLPE myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_006705 |
ORF Size | 477 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_006705.4 |
RefSeq Size | 1087 bp |
RefSeq ORF | 480 bp |
Locus ID | 10912 |
UniProt ID | O95257 |
Cytogenetics | 9q22.2 |
Domains | Ribosomal_L7Ae |
Protein Pathways | Cell cycle, MAPK signaling pathway, p53 signaling pathway |
MW | 17.1 kDa |
Summary | This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta. [provided by RefSeq, Jul 2008] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC201364L1 | Lenti ORF clone of Human growth arrest and DNA-damage-inducible, gamma (GADD45G), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC201364L2 | Lenti ORF clone of Human growth arrest and DNA-damage-inducible, gamma (GADD45G), mGFP tagged | 10 ug |
$450.00
|
|
RC201364L3 | Lenti ORF clone of Human growth arrest and DNA-damage-inducible, gamma (GADD45G), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC201364L4 | Lenti ORF clone of Human growth arrest and DNA-damage-inducible, gamma (GADD45G), mGFP tagged | 10 ug |
$450.00
|
|
RG201364 | GADD45G (tGFP-tagged) - Human growth arrest and DNA-damage-inducible, gamma (GADD45G) | 10 ug |
$489.00
|
|
SC115922 | GADD45G (untagged)-Human growth arrest and DNA-damage-inducible, gamma (GADD45G) | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.