GADD45G (NM_006705) Human Tagged ORF Clone

SKU
RG201364
GADD45G (tGFP-tagged) - Human growth arrest and DNA-damage-inducible, gamma (GADD45G)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GADD45G
Synonyms CR6; DDIT2; GADD45gamma; GRP17
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201364 representing NM_006705
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTCTGGAAGAAGTCCGCGGCCAGGACACAGTTCCGGAAAGCACAGCCAGGATGCAGGGTGCCGGGA
AAGCGCTGCATGAGTTGCTGCTGTCGGCGCAGCGTCAGGGCTGCCTCACTGCCGGCGTCTACGAGTCAGC
CAAAGTCTTGAACGTGGACCCCGACAATGTGACCTTCTGTGTGCTGGCTGCGGGTGAGGAGGACGAGGGC
GACATCGCGCTGCAGATCCATTTTACGCTGATCCAGGCTTTCTGCTGCGAGAACGACATCGACATAGTGC
GCGTGGGCGATGTGCAGCGGCTGGCGGCTATCGTGGGCGCCGGCGAGGAGGCGGGTGCGCCGGGCGACCT
GCACTGCATCCTCATTTCGAACCCCAACGAGGACGCCTGGAAGGATCCCGCCTTGGAGAAGCTCAGCCTG
TTTTGCGAGGAGAGCCGCAGCGTTAACGACTGGGTGCCCAGCATCACCCTCCCCGAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201364 representing NM_006705
Red=Cloning site Green=Tags(s)

MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEG
DIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSL
FCEESRSVNDWVPSITLPE

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006705
ORF Size 477 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006705.4
RefSeq Size 1078 bp
RefSeq ORF 480 bp
Locus ID 10912
UniProt ID O95257
Cytogenetics 9q22.2
Domains Ribosomal_L7Ae
Protein Pathways Cell cycle, MAPK signaling pathway, p53 signaling pathway
Summary This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:GADD45G (NM_006705) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201364 GADD45G (Myc-DDK-tagged)-Human growth arrest and DNA-damage-inducible, gamma (GADD45G) 10 ug
$150.00
RC201364L1 Lenti ORF clone of Human growth arrest and DNA-damage-inducible, gamma (GADD45G), Myc-DDK-tagged 10 ug
$450.00
RC201364L2 Lenti ORF clone of Human growth arrest and DNA-damage-inducible, gamma (GADD45G), mGFP tagged 10 ug
$450.00
RC201364L3 Lenti ORF clone of Human growth arrest and DNA-damage-inducible, gamma (GADD45G), Myc-DDK-tagged 10 ug
$450.00
RC201364L4 Lenti ORF clone of Human growth arrest and DNA-damage-inducible, gamma (GADD45G), mGFP tagged 10 ug
$450.00
SC115922 GADD45G (untagged)-Human growth arrest and DNA-damage-inducible, gamma (GADD45G) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.