SCGN (NM_006998) Human Mass Spec Standard

CAT#: PH301359

SCGN MS Standard C13 and N15-labeled recombinant protein (NP_008929)

Product Images

Coomassie blue staining of purified SCGN protein (Cat# TP301359). The protein was produced from HEK293T cells transfected with SCGN cDNA clone (Cat# RC201359) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201359
• Predicted MW: 31.9 kDa
• Protein Sequence:
  Sequence Link

  >RC201359 representing NM_006998
  Red=Cloning site Green=Tags(s)
  
  MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQ
  DASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLH
  HKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYD
  VSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_008929
• RefSeq Size: 1492
• RefSeq ORF: 828
• Synonyms: CALBL; DJ501N12.8; SECRET; SEGN; setagin
• Locus ID: 10590
• UniProt ID: O76038
• Cytogenetics: 6p22.2
• Summary: The encoded protein is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation. [provided by RefSeq, Jul 2008]